missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Serine racemase (aa 173-272) Control Fragment Recombinant Protein

Recombinant Protein

Brand: Invitrogen™ RP105710

Product Code. 30201852

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

SRR (serine racemase) catalyzes the synthesis of D-serine from L-serine.

Specifications

Accession Number	Q9GZT4
For Use With (Application)	Blocking Assay, Control
Gene ID (Entrez)	63826
Quantity	100 μL
Regulatory Status	RUO
Gene Symbol	Srr
Species	Human
Sequence	QVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQ
Form	Liquid

Concentration	≥5.0 mg/mL
Formulation	1M urea, PBS with no preservative; pH 7.4
Name	Serine racemase
Storage Requirements	-20° C, Avoid Freeze/Thaw Cycles
Gene Alias	D-serine ammonia-lyase; D-serine dehydratase; ILV1; ISO1; L-serine ammonia-lyase; L-serine dehydratase; Serine racemase; SRR; Srs
Conjugate	Unconjugated
Recombinant	Recombinant
Expression System	E. coli

Product Suggestions

Description