missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SDS (aa 82-154) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP97731
This item is not returnable.
View return policy
Description
SDS encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor. The encoded protein can also metabolize threonine to NH4+ and 2-ketobutyrate. The encoded protein is found predominantly in the liver.
Specifications
| P20132 | |
| Blocking Assay, Control | |
| 10993 | |
| 100 μL | |
| RUO | |
| SDS | |
| Human | |
| PATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKE | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| SDS | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| 4432411H13Rik; L-serine ammonia-lyase; L-serine deaminase; L-serine dehydratase; L-serine dehydratase/L-threonine deaminase; L-threonine dehydratase; RATSDHE1; Sdh; SDH2; Sdhe1; SDS; serine dehydratase; TDH | |
| Unconjugated | |
| Recombinant | |
| E. coli |