missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201499

Invitrogen™ Human MOZ (aa 1330-1404) Control Fragment Recombinant Protein

Product Code. 30201499
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201499

Brand: Invitrogen™ RP107398

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66742 (PA5-66742. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Histone acetyltransferase that acetylates lysine residues in histone H3 and histone H4 (in vitro). Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. May act as a transcriptional coactivator for RUNX1 and RUNX2. Acetylates p53/TP53 at 'Lys-120' and 'Lys-382' and controls its transcriptional activity via association with PML.
TRUSTED_SUSTAINABILITY

Especificaciones

Accession Number Q92794
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7994
Name Human MOZ (aa 1330-1404) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1500036M03; 9930021N24Rik; histone acetyltransferase KAT6A; histone acetyltransferase MYST3; K(lysine) acetyltransferase 6 A; KAT6A; lysine acetyltransferase 6 A; monocytic leukemia zinc finger homolog; Monocytic leukemia zinc finger protein; Moz; MOZ, YBF2/SAS3, SAS2 and TIP60 protein 3; MRD32; MYST histone acetyltransferase (monocytic leukemia) 3; Myst3; MYST-3; runt-related transcription factor binding protein 2; Runt-related transcription factor-binding protein 2; RUNXBP2; ZC2HC6A; Zfp220; zinc finger protein 220; ZNF220
Common Name MOZ
Gene Symbol Kat6a
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KELEEQPTREDVKEEPGVQESFLDANMQKSREKIKDKEETELDSEEEQPSHDTSVVSEQMAGSEDDHEEDSHTKE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado