missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human MEP1A (aa 521-656) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP90933
This item is not returnable.
View return policy
Description
MEP1A (Meprin A Subunit Alpha) is a Protein Coding gene. Among its related pathways are Collagen chain trimerization. Gene Ontology (GO) annotations related to this gene include metalloendopeptidase activity and metallopeptidase activity.
Specifications
| Q16819 | |
| Blocking Assay, Control | |
| 4224 | |
| 100 μL | |
| RUO | |
| MEP1A | |
| Human | |
| MSSSMVFTTSKSHTSPAINDTVIWDRPSRVGTYHTDCNCFRSIDLGWSGFISHQMLKRRSFLKNDDLIIFVDFEDITHLSQTEVPTKGKRLSPQGLILQGQEQQVSEEGSGKAMLEEALPVSLSQGQPSRQKRSVE | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| MEP1A | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| AI098089; AW107200; bA268F1.1 (meprin A alpha (PABA peptide hydrolase)); E-24.18; Endopeptidase-2; endopeptidase-24.18 subunit alpha; Mep1; Mep-1; MEP1A; Mep-1a; meprin 1 alpha; meprin A alpha; meprin A alpha-subunit; meprin A subunit alpha; meprin A, alpha (PABA peptide hydrolase); meprin alpha; N-benzoyl-L-tyrosyl-P-amino-benzoic acid hydrolase subunit alpha; PABA peptide hydrolase; PPH alpha; PPHA | |
| Unconjugated | |
| Recombinant | |
| E. coli |