missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human LGSN (aa 98-186) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP104711
This item is not returnable.
View return policy
Description
May act as a component of the cytoskeleton or as a chaperone for the reorganization of intermediate filament proteins during terminal differentiation in the lens. Does not seem to have enzymatic activity.Specifications
Q5TDP6 | |
Blocking Assay, Control | |
51557 | |
100 μL | |
RUO | |
LGSN | |
Human | |
VSRSKTIPAHFFQEKVSHGVCMPRGYLEVIPNPKDNEMNNIRATCFNSDIVLMPELSTFRVLPWADRTARVICDTFTVTGEPLLTSPRY | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
LGSN | |
-20° C, Avoid Freeze/Thaw Cycles | |
GLULD1; glutamate-ammonia ligase (glutamine synthase) domain containing 1; glutamate-ammonia ligase domain-containing protein 1; Lengsin; lengsin, lens protein with glutamine synthetase domain; Lens glutamine synthase-like; LGS; LGSN | |
Unconjugated | |
Recombinant | |
E. coli |