missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human HAL (aa 263-360) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP97641
This item is not returnable.
View return policy
Description
HAL is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. HAL defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids Histidine ammonia-lyase is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. Histidine ammonia-lyase defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids.
Specifications
| P42357 | |
| Blocking Assay, Control | |
| 3034 | |
| 100 μL | |
| RUO | |
| HAL | |
| Human | |
| LALGLVGEGKMWSPKSGWADAKYVLEAHGLKPVILKPKEGLALINGTQMITSLGCEAVERASAIARQADIVAALTLEVLKGTTKAFDTDIHALRPHRG | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| HAL | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| hal; HIS; histidase; histidine ammonia lyase; histidine ammonia-lyase; histidinemia; Hsd; HSTD; Huth; zgc:136980 | |
| Unconjugated | |
| Recombinant | |
| E. coli |