missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Glutamine Synthetase (aa 227-365) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP88686
This item is not returnable.
View return policy
Description
Glutamine synthase is part of the glutamine synthetase family. Ammonia incorporation in animals occurs through the actions of glutamate dehydrogenase and glutamine synthase. Glutamate plays the central role in mammalian nitrogen flow, serving as both a nitrogen donor and nitrogen acceptor. It also has an important role in controlling metabolic regulations of neurotransmitter glutamate. Because of the multiple functions and importance of GS in cellular metabolism, both catalytic activities and synthesis are highly regulated. The activity of GS is controlled by adenylylation. Its activity is decreased in the cerebral cortex of brains affected by Alzheimer's disease, particularly in the vicinity of senile plaques. It is also decreased under conditions of glucose deprivation.
Specifications
| P15104 | |
| Blocking Assay, Control | |
| 2752 | |
| 100 μL | |
| RUO | |
| GLUL | |
| Recombinant | |
| E. coli |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| Glutamine Synthetase | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| cell proliferation-inducing protein 59; GLNA; GLNS; Glul; GLUL protein; Glutamate ammonia ligase; glutamate decarboxylase; glutamate-ammonia ligase; glutamate--ammonia ligase; glutamate-ammonia ligase (glutamine synthase); glutamate-ammonia ligase (glutamine synthetase); glutamine synthase; glutamine synthetase; Glutamine synthetase (glutamate-ammonia ligase); glutamine synthetase 1; glutamine synthetase I; GS; Palmitoyltransferase GLUL; PIG43; PIG59; Proliferation inducing protein 43; proliferation-inducing protein 43 | |
| Unconjugated | |
| RVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG |