missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ESRP1 (aa 23-102) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP105415
176.67 EUR valid until 2025-03-29
Use promo code "24111" to get your promotional price.
Alert:
To receive the discount customers must purchase three of the same product at list price in a single order to receive 33% discount. There is no limit to the multiples of 3 that customers can buy. Use promo code ”24111” to get your promotional price
Description
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84744 (PA5-84744. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
RBM35A, also known as ESRP1, is a mRNA splicing factor that with its related protein RBM35B (ESRP2) are coordinators of an epithelial cell-type-specific splicing program. RBM35A contains three putative RNA recognition motifs and acts by directly binding specific sequences in mRNAs. RBM35A is involved in posttranscriptional regulation of a number of genes such as FGFR2, CD44, CTNND1, and ENAH by exerting a differential effect on protein translation via 5' UTRs of mRNAs. Other recent studies have shown that RMB35A may also act as a novel tumor suppressor.
Specifications
| Q6NXG1 | |
| Blocking Assay, Control | |
| 54845 | |
| 100 μL | |
| 2210008M09Rik; A630065D16; BC031468; epithelial splicing regulatory protein 1; Esrp1; Rbm35a; RGD1560481; RMB35A; RNA binding motif protein 35 A; RNA-binding motif protein 35 A; RNA-binding protein 35 A | |
| ESRP1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ESRP1 (aa 23-102) Control Fragment | |
| RUO | |
| ESRP1 | |
| Unconjugated | |
| Recombinant | |
| LGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKIDVESLSSASQLDQALRQFNQSVSNELNIGVGT | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Invitrogen™ Human ESRP1 (aa 23-102) Control Fragment Recombinant Protein > 100 μL; Unlabeled
Spot an opportunity for improvement?Share a Content Correction
