missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human EphB6 (aa 37-131) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP105909
This item is not returnable.
View return policy
Description
Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The ephrin receptor encoded by this gene lacks the kinase activity of most receptor tyrosine kinases and binds to ephrin-B ligands.Specifications
O15197 | |
Blocking Assay, Control | |
2051 | |
100 μL | |
RUO | |
EPHB6 | |
Human | |
LDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLY | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
EphB6 | |
-20° C, Avoid Freeze/Thaw Cycles | |
Cekl; chicken eph/elk receptor-like protein; EPB6; EPH receptor B6; EPHB6; EphB6v; Epherin B6; Epherin receptor B6; ephrin type A receptor; ephrin type-B receptor 6; HEP; human kinase-defective Eph-family receptor protein; MEP; MGC129910; MGC129911; Tyrosine-protein kinase-defective receptor EPH-6 | |
Unconjugated | |
Recombinant | |
E. coli |