missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200951

Invitrogen™ Human DMWD (aa 513-557) Control Fragment Recombinant Protein

Product Code. 30200951
Click to view available options
Quantity:
100 μL
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30200951

Marque: Invitrogen™ RP103842

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64364 (PA5-64364. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DMWD (DM1 Locus, WD Repeat Containing) is a Protein Coding gene. Diseases associated with DMWD include Myotonic Dystrophy 1 and Corticosteroid Allergy. An important paralog of this gene is WDR20. [GeneCards]
TRUSTED_SUSTAINABILITY

Spécification

Accession Number Q09019
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1762
Name Human DMWD (aa 513-557) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias D19S593E; Dm9; DMRN9; DMR-N9; DMWD; dystrophia myotonica linked gene, N9; dystrophia myotonica WD repeat-containing protein; dystrophia myotonica, WD repeat containing; dystrophia myotonica-containing WD repeat motif; dystrophia myotonica-containing WD repeat motif protein; gene59; Protein 59; Protein DMR-N9
Common Name DMWD
Gene Symbol Dmwd
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EPGTPFSIGRFATLTLQERRDRGAEKEHKRYHSLGNISRGGSGGS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis