missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CTPS2 (aa 397-507) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP91884
This item is not returnable.
View return policy
Description
The protein encoded by this gene catalyzes the formation of CTP from UTP with the concomitant deamination of glutamine to glutamate. This protein is the rate-limiting enzyme in the synthesis of cytosine nucleotides, which play an important role in various metabolic processes and provide the precursors necessary for the synthesis of RNA and DNA. Cancer cells that exhibit increased cell proliferation also exhibit an increased activity of this encoded protein. Thus, this protein is an attractive target for selective chemotherapy. Alternative splicing results in multiple transcript variants.Specifications
Q9NRF8 | |
Blocking Assay, Control | |
56474 | |
100 μL | |
RUO | |
Ctps2 | |
Human | |
GVCLGMQLAVIEFARNCLNLKDADSTEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRHRFEVNPNLIKQFEQNDLSFVGQDVDGD | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
CTPS2 | |
-20° C, Avoid Freeze/Thaw Cycles | |
A830031M15Rik; AI326475; CTP synthase 2; CTP synthase II; CTP synthetase 2; CTP synthetase homolog; CTP synthetase type 2; CTPS2; CTPsH; cytidine 5'-triphosphate synthase 2; cytidine 5'-triphosphate synthetase 2; cytidine triphosphate synthase II; UTP-ammonia ligase 2; UTP--ammonia ligase 2 | |
Unconjugated | |
Recombinant | |
E. coli |