missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CPS1 Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP102361
This item is not returnable.
View return policy
Description
The mitochondrial enzyme encoded by this gene catalyzes synthesis of carbamoyl phosphate from ammonia and bicarbonate. This reaction is the first committed step of the urea cycle, which is important in the removal of excess urea from cells. The encoded protein may also represent a core mitochondrial nucleoid protein. Three transcript variants encoding different isoforms have been found for this gene. The shortest isoform may not be localized to the mitochondrion. Mutations in this gene have been associated with carbamoyl phosphate synthetase deficiency, susceptibility to persistent pulmonary hypertension, and susceptibility to venoocclusive disease after bone marrow transplantation.Specifications
P31327 | |
Blocking Assay, Control | |
1373 | |
100 μL | |
RUO | |
CPS1 | |
Human | |
FKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPANPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSA | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
CPS1 | |
-20° C, Avoid Freeze/Thaw Cycles | |
4732433M03Rik; carbamoyl-phosphate synthase (ammonia); carbamoyl-phosphate synthase [ammonia], mitochondrial; carbamoyl-phosphate synthase 1; carbamoyl-phosphate synthase 1, mitochondrial; carbamoyl-phosphate synthetase 1; carbamoyl-phosphate synthetase 1, mitochondrial; carbamoylphosphate synthetase I; carbamoyl-phosphate synthetase I; carbamyl phosphate synthetase I; carboamyl-phosphate synthetase 1; cps; CPS1; CPSase I; CPSASE1; CPSI; D1Ucla3; PHN | |
Unconjugated | |
Recombinant | |
E. coli |