missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CD48 (aa 99-161) Control Fragment Recombinant Protein

Product Code. 30202621
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202621

Brand: Invitrogen™ RP106607

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84241 (PA5-84241. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD48 (Blast-1) belongs to the CD2 subset of the Ig superfamily that includes CD2, CD2F-10, CD58, CD84, CD150, CD229, CD244 and others. These molecules bind to the same or another members of the Ig family, thus mediating homotypic or heterotypic adhesion. CD48 is a GPI-anchored protein broadly expressed on hematopoietic cells and serves as a high affinity ligand for 2B4 and low affinity ligand for CD2. 2B4-CD48 interaction among NK cells and NK-T cells regulates cell proliferation. Further, signaling through CD48 results in eosinophil activation and CD48 expression is increased in several infectious diseases. CD48 is strongly expressed on lymphocytes and monocytes, weakly on granulocytes but is absent on platelets, fibroblasts, epithelium and endothelium. CD48 is one of marker for detecting the defects of GPI anchoring structure on the patients with paroxysmal nocturnal hemoglobulinuria (PNH) and serves as a low affinity ligand for CD2. 2B4-CD48 interaction may be involved in the pathology of allergic airway diseases and provide a pharmacological target for the treatment of diseases such as allergic rhinitis and asthma.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P09326
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 962
Name Human CD48 (aa 99-161) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI449234; AW610730; B-cell activation marker; BCM1; Bcm-1; BCM1 surface antigen; BLAST; BLAST1; BLAST-1; B-lymphocyte activation marker BLAST-1; Cd48; CD48 antigen; CD48 antigen (B cell membrane protein); CD48 antigen (B-cell membrane protein); Cd48 molecule; CD48d; hCD48; HM48-1; leukocyte antigen MEM-102; mCD48; MEM-102; MRC OX-45 surface antigen; sCD 48; sCD48; Sgp-60; Signaling lymphocytic activation molecule 2; Signaling lymphocytic activation molecule 2 (SLAMF2); SLAM family member 2; SLAMF2; soluble CD 48; soluble CD48; TCT0.1
Common Name CD48
Gene Symbol Cd48
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.