missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Cathepsin L (aa 13-42) Control Fragment Recombinant Protein

Recombinant Protein

Brand:  Invitrogen™ RP109208

176.67 EUR valid until 2025-03-21
Use promo code "24111" to get your promotional price.


Product Code. 30206052

  • € 265.00 / 100µL

Please to purchase this item. Need a web account? Register with us today!

Explore more special offers

Alert:

To receive the discount customers must purchase three of the same product at list price in a single order to receive 33% discount. There is no limit to the multiples of 3 that customers can buy. Use promo code ”24111” to get your promotional price

This item is not returnable. View return policy

Description

Description

Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a lysosomal cysteine proteinase that plays a major role in intracellular protein catabolism. Its substrates include collagen and elastin, as well as alpha-1 protease inhibitor, a major controlling element of neutrophil elastase activity. The encoded protein has been implicated in several pathologic processes, including myofibril necrosis in myopathies and in myocardial ischemia, and in the renal tubular response to proteinuria. This protein, which is a member of the peptidase C1 family, is a dimer composed of disulfide-linked heavy and light chains, both produced from a single protein precursor. At least two transcript variants encoding the same protein have been found for this gene.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

P07711
Blocking Assay, Control
1514
100 μL
1190035F06Rik; Cat L; cathepsin L; Cathepsin L1; Cathepsin L1 heavy chain; Cathepsin L1 light chain; CATHL; CatL; CP-2; Ctsl; CTSL1; cyclic protein 2; fs; furless; major excreted protein; MEP; nackt; nkt; p39 cysteine proteinase; Procathepsin L
CTSL
Human
His-ABP-tag
-20°C, Avoid Freeze/Thaw Cycles
Liquid
≥5.0 mg/mL
1 M urea, PBS with no preservative; pH 7.4
Human Cathepsin L (aa 13-42) Control Fragment
RUO
Cathepsin L
Unconjugated
Recombinant
GIASATLTFDHSLEAQWTKWKAMHNRLYGM
E. coli
>80% by SDS-PAGE and Coomassie blue staining
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.