Learn More
Invitrogen™ Human Cathepsin L (aa 13-42) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP109208
176.67 EUR valid until 2025-03-21
Use promo code "24111" to get your promotional price.
Alert:
To receive the discount customers must purchase three of the same product at list price in a single order to receive 33% discount. There is no limit to the multiples of 3 that customers can buy. Use promo code ”24111” to get your promotional price
Description
Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is a lysosomal cysteine proteinase that plays a major role in intracellular protein catabolism. Its substrates include collagen and elastin, as well as alpha-1 protease inhibitor, a major controlling element of neutrophil elastase activity. The encoded protein has been implicated in several pathologic processes, including myofibril necrosis in myopathies and in myocardial ischemia, and in the renal tubular response to proteinuria. This protein, which is a member of the peptidase C1 family, is a dimer composed of disulfide-linked heavy and light chains, both produced from a single protein precursor. At least two transcript variants encoding the same protein have been found for this gene.
Specifications
P07711 | |
Blocking Assay, Control | |
1514 | |
100 μL | |
1190035F06Rik; Cat L; cathepsin L; Cathepsin L1; Cathepsin L1 heavy chain; Cathepsin L1 light chain; CATHL; CatL; CP-2; Ctsl; CTSL1; cyclic protein 2; fs; furless; major excreted protein; MEP; nackt; nkt; p39 cysteine proteinase; Procathepsin L | |
CTSL | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Cathepsin L (aa 13-42) Control Fragment | |
RUO | |
Cathepsin L | |
Unconjugated | |
Recombinant | |
GIASATLTFDHSLEAQWTKWKAMHNRLYGM | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.