missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ATPBD4 (aa 7-89) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP98065
This item is not returnable.
View return policy
Description
Amidase that catalyzes the last step of diphthamide biosynthesis using ammonium and ATP. Diphthamide biosynthesis consists in the conversion of an L-histidine residue in the translation elongation factor (EEF2) to diphthamide.
Specifications
| Q7L8W6 | |
| Blocking Assay, Control | |
| 89978 | |
| 100 μL | |
| RUO | |
| DPH6 | |
| Human | |
| ISGGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDLYAEAMALPLYRRTIRGRSLDTRQVYTKCE | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| ATPBD4 | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| 5730421E18Rik; ATP binding domain 4; Atpbd4; ATP-binding domain-containing protein 4; diphthamide synthase; Diphthamide synthetase; diphthamine biosynthesis 6; diphthine--ammonia ligase; DPH6; DPH6 homolog; protein DPH6 homolog | |
| Unconjugated | |
| Recombinant | |
| E. coli |