Learn More
Invitrogen™ Human ATPBD4 (aa 7-89) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP98065
Description
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60181 (PA5-60181. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Amidase that catalyzes the last step of diphthamide biosynthesis using ammonium and ATP. Diphthamide biosynthesis consists in the conversion of an L-histidine residue in the translation elongation factor (EEF2) to diphthamide.
Specifications
Q7L8W6 | |
Blocking Assay, Control | |
89978 | |
100 μL | |
5730421E18Rik; ATP binding domain 4; Atpbd4; ATP-binding domain-containing protein 4; diphthamide synthase; Diphthamide synthetase; diphthamine biosynthesis 6; diphthine--ammonia ligase; DPH6; DPH6 homolog; protein DPH6 homolog | |
DPH6 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ATPBD4 (aa 7-89) Control Fragment | |
RUO | |
ATPBD4 | |
Unconjugated | |
Recombinant | |
ISGGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDLYAEAMALPLYRRTIRGRSLDTRQVYTKCE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.